NSJ Bioreagents

EEF2 Antibody / Elongation factor 2

Product Code:
 
NSJ-RQ6253
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Monkey
  • Mouse
  • Rat
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Immunofluorescence (IF)
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the Elongation factor 2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
1 / 13
Western blot testing of rat 1) kidney, 2) lung, 3) stomach, 4) C6 and mouse 5) kidney, 6) lung, 7) stomach and 8) NIH 3T3 cell lysate with Elongation factor 2 antibody. Predicted molecular weight ~95 kDa.
2 / 13
Western blot testing of 1) human Jurkat, 2) monkey COS-7 and human 3) HeLa, 4) U-2 OS, 5) HEK293, 6) HepG2 and 7) placenta lysate with Elongation factor 2 antibody. Predicted molecular weight ~95 kDa.
3 / 13
IHC staining of FFPE human gastric cancer with Elongation factor 2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
4 / 13
IHC staining of FFPE human ovarian cancer with Elongation factor 2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
5 / 13
IHC staining of FFPE human ovarian cancer with Elongation factor 2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
6 / 13
IHC staining of FFPE human rectal cancer with Elongation factor 2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
7 / 13
IHC staining of FFPE human prostate cancer with Elongation factor 2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
8 / 13
IHC staining of FFPE human breast cancer with Elongation factor 2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
9 / 13
IHC staining of FFPE human esophageal squamous carcinoma tissue with Elongation factor 2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
10 / 13
IHC staining of FFPE mouse brain tissue with Elongation factor 2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
11 / 13
IHC staining of FFPE rat brain tissue with Elongation factor 2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
12 / 13
Immunofluorescent staining of FFPE human A431 cells with Elongation factor 2 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
13 / 13
Flow cytometry testing of human U937 cells with Elongation factor 2 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Elongation factor 2 antibody.

Western blot testing of rat 1) kidney, 2) lung, 3) stomach, 4) C6 and mouse 5) kidney, 6) lung, 7) stomach and 8) NIH 3T3 cell lysate with Elongation factor 2 antibody. Predicted molecular weight ~95 kDa.
Western blot testing of 1) human Jurkat, 2) monkey COS-7 and human 3) HeLa, 4) U-2 OS, 5) HEK293, 6) HepG2 and 7) placenta lysate with Elongation factor 2 antibody. Predicted molecular weight ~95 kDa.
IHC staining of FFPE human gastric cancer with Elongation factor 2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human ovarian cancer with Elongation factor 2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human ovarian cancer with Elongation factor 2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human rectal cancer with Elongation factor 2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human prostate cancer with Elongation factor 2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human breast cancer with Elongation factor 2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human esophageal squamous carcinoma tissue with Elongation factor 2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE mouse brain tissue with Elongation factor 2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE rat brain tissue with Elongation factor 2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Immunofluorescent staining of FFPE human A431 cells with Elongation factor 2 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Flow cytometry testing of human U937 cells with Elongation factor 2 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Elongation factor 2 antibody.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-RQ6253-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 1-2ug/ml,Immunohistochemistry (FFPE): 2-5ug/ml,Immunofluorescence: 5ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the Elongation factor 2 antibody should be determined by the researcher.
Description:
Eukaryotic elongation factor 2 is a protein that in humans is encoded by the EEF2 gene. This gene encodes a member of the GTP-binding translation elongation factor family. This protein is an essential factor for protein synthesis. It promotes the GTP-dependent translocation of the nascent protein chain from the A-site to the P-site of the ribosome. This protein is completely inactivated by EF-2 kinase phosporylation.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids QTETVLRQAIAERIKPVLMMNKMDRALLELQLEPEELYQTFQR from the human protein were used as the immunogen for the Elongation factor 2 antibody.
Limitation:
This Elongation factor 2 antibody is available for research use only.
Localization:
Cytoplasmic, nuclear
Purity:
Affinity purified
Species Reactivity :
Human, Mouse, Rat, Monkey
Uniprot #:
P13639