NSJ Bioreagents

CHTOP Antibody / Chromatin target of PRMT1 protein / C1orf77

Product Code:
 
NSJ-RQ7159
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Monkey
  • Mouse
  • Rat
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the CHTOP antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
1 / 9
IHC staining of FFPE human thyroid cancer tissue with CHTOP antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
2 / 9
IHC staining of FFPE human colorectal adenocarcinoma tissue with CHTOP antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
3 / 9
IHC staining of FFPE human breast cancer tissue with CHTOP antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
4 / 9
IHC staining of FFPE human spleen tissue with CHTOP antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
5 / 9
IHC staining of FFPE human laryngeal squamous cell carcinoma tissue with CHTOP antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
6 / 9
IHC staining of FFPE human placental tissue with CHTOP antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
7 / 9
Western blot testing of 1) human HeLa, 2) monkey COS-7, 3) human ThP-1, 4) human MOLT-4, 5) human RT4, 6) human HL-60, 7) human MCF-7, 8) rat brain, 9) rat PC-12, 10) mouse spleen, 11) mouse brain, 12) mouse lung and 12) mouse L929 cell lysate with CHTOP antibody. Predicted molecular weight ~26 kDa.
8 / 9
Flow cytometry testing of human ThP-1 cells with CHTOP antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= CHTOP antibody.
9 / 9
Flow cytometry testing of rat RH35 cells with CHTOP antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= CHTOP antibody.

IHC staining of FFPE human thyroid cancer tissue with CHTOP antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human colorectal adenocarcinoma tissue with CHTOP antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human breast cancer tissue with CHTOP antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human spleen tissue with CHTOP antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human laryngeal squamous cell carcinoma tissue with CHTOP antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human placental tissue with CHTOP antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Western blot testing of 1) human HeLa, 2) monkey COS-7, 3) human ThP-1, 4) human MOLT-4, 5) human RT4, 6) human HL-60, 7) human MCF-7, 8) rat brain, 9) rat PC-12, 10) mouse spleen, 11) mouse brain, 12) mouse lung and 12) mouse L929 cell lysate with CHTOP antibody. Predicted molecular weight ~26 kDa.
Flow cytometry testing of human ThP-1 cells with CHTOP antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= CHTOP antibody.
Flow cytometry testing of rat RH35 cells with CHTOP antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= CHTOP antibody.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-RQ7159-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details:
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 2-5ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the CHTOP antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose
Description:
This gene encodes a small nuclear protein that is characterized by an arginine and glycine rich region. This protein may have an important role in the regulation of fetal globin gene expression and in the activation of estrogen-responsive genes. A recent study reported that this protein binds 5-hydroxymethylcytosine (5hmC) and associates with an arginine methyltransferase complex (methylosome), which promotes methylation of arginine 3 of histone H4 (H4R3) and activation of genes involved in glioblastomagenesis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Format:
Antigen affinity purified
Formulation:
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids AAQSAPKVVLKSTTKMSLNERFTNMLKNKQ were used as the immunogen for the CHTOP antibody.
Limitation:
This CHTOP antibody is available for research use only.
Localization:
Nuclear
Purity:
Antigen affinity purified
Uniprot #:
Q9Y3Y2

Documents