NSJ Bioreagents

ACO2 Antibody / Aconitase 2

Product Code:
 
NSJ-RQ7281
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Mouse
Antibody Isotype:
 
Mouse IgG1
Antibody Clonality:
 
Monoclonal
Antibody Clone:
 
4C12D1
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the ACO2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
1 / 8
IHC staining of FFPE human testicular germ cell tumor tissue with ACO2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
2 / 8
IHC staining of FFPE human lung adenocarcinoma tissue with ACO2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
3 / 8
IHC staining of FFPE human hepatocellular carcinoma tissue with ACO2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
4 / 8
IHC staining of FFPE human laryngeal squamous cell carcinoma tissue with ACO2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
5 / 8
IHC staining of FFPE human breast cancer tissue with ACO2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
6 / 8
IHC staining of FFPE mouse heart tissue with ACO2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
7 / 8
IHC staining of FFPE rat heart tissue with ACO2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
8 / 8
Western blot testing of 1) human HeLa, 2) human U-87 MG, 3) human Jurkat, 4) human SH-SY5Y, 5) rat skeletal muscle, 6) rat brain, 7) mouse skeletal muscle and 8) mouse brain tissue lysate with ACO2 antibody. Predicted molecular weight: ~85 kDa.

IHC staining of FFPE human testicular germ cell tumor tissue with ACO2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human lung adenocarcinoma tissue with ACO2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human hepatocellular carcinoma tissue with ACO2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human laryngeal squamous cell carcinoma tissue with ACO2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human breast cancer tissue with ACO2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE mouse heart tissue with ACO2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE rat heart tissue with ACO2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Western blot testing of 1) human HeLa, 2) human U-87 MG, 3) human Jurkat, 4) human SH-SY5Y, 5) rat skeletal muscle, 6) rat brain, 7) mouse skeletal muscle and 8) mouse brain tissue lysate with ACO2 antibody. Predicted molecular weight: ~85 kDa.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-RQ7281-100UG100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details:
Western blot: 0.5-1ug/ml, Immunohistochemistry (FFPE): 2-5ug/ml
Application Note:
Optimal dilution of the ACO2 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose
Description:
Aconitase 2, mitochondrial (also called Aconitate hydratase, mitochondrial) is a protein that in humans is encoded by the ACO2 gene. The protein encoded by this gene belongs to the aconitase/IPM isomerase family. It is an enzyme that catalyzes the interconversion of citrate to isocitrate via cis-aconitate in the second step of the TCA cycle. This protein is encoded in the nucleus and functions in the mitochondrion. It was found to be one of the mitochondrial matrix proteins that are preferentially degraded by the serine protease 15 (PRSS15), also known as Lon protease, after oxidative modification.
Format:
Antigen affinity purified
Formulation:
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids 561-596 (TSQRLQLLEPFDKWDGKDLEDLQILIKVKGKCTTDH) were used as the immunogen for the ACO2 antibody.
Limitation:
This ACO2 antibody is available for research use only.
Localization:
Cytoplasmic (mitochondria)
Purity:
Antigen affinity purified
Uniprot #:
Q99798

Documents