NSJ Bioreagents

FXR Antibody / Farnesoid X Receptor / Bile Acid Receptor NR1H4 (C-Terminal Region)

Product Code:
 
NSJ-R32869
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
Application:
 
Western Blot (WB)
Storage:
 
After reconstitution, the NR1H4 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 3
IF/ICC staining of FFPE human A549 cells with NR1H4 antibody (green) at 2ug/ml and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
2 / 3
Western blot testing of human 1) HCCT and 2) HCCP cell lysate with NR1H4 antibody at 0.5ug/ml. Predicted molecular weight ~54 kDa.
3 / 3
Flow cytometry testing of human A549 cells with NR1H4 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= NR1H4 antibody.
❮❯

IF/ICC staining of FFPE human A549 cells with NR1H4 antibody (green) at 2ug/ml and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Western blot testing of human 1) HCCT and 2) HCCP cell lysate with NR1H4 antibody at 0.5ug/ml. Predicted molecular weight ~54 kDa.
Flow cytometry testing of human A549 cells with NR1H4 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= NR1H4 antibody.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R32869-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
How to order with us   Contact us
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western Blot: 0.5-1ug/ml,Immunofluorescence: 2-4ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the NR1H4 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
Description:
The bile acid receptor (BAR), also known as farnesoid X receptor (FXR) or NR1H4 (nuclear receptor subfamily 1, group H, member 4) is a nuclear receptor that is encoded by the NR1H4 gene in humans. This gene encodes a ligand-activated transcription factor that shares structural features in common with nuclear hormone receptor family members. This protein functions as a receptor for bile acids, and when bound to bile acids, binds to DNA and regulates the expression of genes involved in bile acid synthesis and transport.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids 442-486 (QHFACLLGRLTELRTFNHHHAEMLMSWRVNDHKFTPLLCEIWDVQ) were used as the immunogen for the NR1H4 antibody.
Limitation:
This NR1H4 antibody is available for research use only.
Purity:
Antigen affinity
Species Reactivity :
Human
Uniprot #:
Q96RI1