NSJ Bioreagents

NANOG Antibody

Product Code:
 
NSJ-R32790
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Application:
 
Western Blot (WB)
Storage:
 
After reconstitution, the NANOG antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 3
Western blot testing of 1) rat ovary, 2) mouse ovary and 3) human MCF7 cell lysate with NANOG antibody at 0.5ug/ml. Predicted molecular weight: 35-45 kDa.
2 / 3
Flow cytometry testing of human A549 cells with NANOG antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= NANOG antibody.
3 / 3
Flow cytometry testing of human PC-3 cells with NANOG antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= NANOG antibody.
❮❯

Western blot testing of 1) rat ovary, 2) mouse ovary and 3) human MCF7 cell lysate with NANOG antibody at 0.5ug/ml. Predicted molecular weight: 35-45 kDa.
Flow cytometry testing of human A549 cells with NANOG antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= NANOG antibody.
Flow cytometry testing of human PC-3 cells with NANOG antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= NANOG antibody.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R32790-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT
How to order with us   Contact us
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the NANOG antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
Description:
NANOG is a transcription factor critically involved with self-renewal of undifferentiated embryonic stem cells. In humans, this protein is encoded by the NANOG gene. It is mapped to 12p13.31. NANOG is thought to be a key factor in maintaining pluripotency. Moreover, NANOG is also thought to function in concert with other factors such as POU5F1 (Oct-4) and SOX2 to establish ESC identity. The NANOG protein has been found to be a transcriptional activator for the Rex1 promoter, playing a key role in sustaining Rex1 expression. Knockdown of NANOG in embryonic stem cells results in a reduction of Rex1 expression, while forced expression of NANOG stimulates Rex1 expression.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids 115-155 (QRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQK) from the human protein were used as the immunogen for the NANOG antibody.
Limitation:
This NANOG antibody is available for research use only.
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
Q9H9S0