NSJ Bioreagents

TGFB2 Antibody / TGF beta 2

Product Code:
 
NSJ-RQ4448
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
 
Human
Application:
 
Western Blot (WB)
Storage:
 
After reconstitution, the TGFB2 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 2
Western blot testing of human 1) HeLa, 2) placenta, 3) MBA-MB-453, 4) HepG2, 5) A549, 6) U-87 MG and 7) COLO-320 lysate with TGFB2 antibody at 0.5ug/ml. Predicted molecular weight ~50 kDa.
2 / 2
IHC staining of FFPE human lung cancer with TGFB2 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.

Western blot testing of human 1) HeLa, 2) placenta, 3) MBA-MB-453, 4) HepG2, 5) A549, 6) U-87 MG and 7) COLO-320 lysate with TGFB2 antibody at 0.5ug/ml. Predicted molecular weight ~50 kDa.
IHC staining of FFPE human lung cancer with TGFB2 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-RQ4448-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.5-1ug/ml, Immunohistochemistry (FFPE): 1-2ug/ml
Application Note:
Optimal dilution of the TGFB2 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate a latency-associated peptide (LAP) and a mature peptide, and is found in either a latent form composed of a mature peptide homodimer, a LAP homodimer, and a latent TGF-beta binding protein, or in an active form consisting solely of the mature peptide homodimer. The mature peptide may also form heterodimers with other TGF-beta family members. Disruption of the TGF-beta/SMAD pathway has been implicated in a variety of human cancers. A chromosomal translocation that includes this gene is associated with Peters' anomaly, a congenital defect of the anterior chamber of the eye. Mutations in this gene may be associated with Loeys-Dietz syndrome. This gene encodes multiple isoforms that may undergo similar proteolytic processing.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPK were used as the immunogen for the TGFB2 antibody.
Limitation:
This TGFB2 antibody is available for research use only.
Localization:
Secreted
Purity:
Antigen affinity
Species Reactivity :
Human
Uniprot #:
P61812