NSJ Bioreagents

Calcitonin Antibody / CALCA / CGRP

Product Code:
 
NSJ-RQ4462
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Mouse
  • Rat
Application:
 
Immunohistochemistry- Paraffin Embedded (IHC-P)
Storage:
 
After reconstitution, the Calcitonin antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 2
IHC testing of FFPE mouse brain with Calcitonin antibody at 2ug/ml. HIER: steamed antigen retrieval with pH6 citrate buffer.
2 / 2
IHC testing of FFPE rat brain with Calcitonin antibody at 2ug/ml. HIER: steamed antigen retrieval with pH6 citrate buffer.
❮❯

IHC testing of FFPE mouse brain with Calcitonin antibody at 2ug/ml. HIER: steamed antigen retrieval with pH6 citrate buffer.
IHC testing of FFPE rat brain with Calcitonin antibody at 2ug/ml. HIER: steamed antigen retrieval with pH6 citrate buffer.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-RQ4462-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT
How to order with us   Contact us
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Immunohistochemistry (FFPE): 1-2ug/ml
Application Note:
Optimal dilution of the Calcitonin antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
Calcitonin, also known as CALCA, is a peptide hormone synthesized by the parafollicular cells of the thyroid. It is mapped to 11p15.2. Calcitonin belongs to the calcitonin-like protein family. Calcitonin is involved in calcium regulation and acts to regulate phosphorus metabolism. Calcitonin gene-related peptide functions as a vasodilator and as an antimicrobial peptide while katacalcin is a calcium-lowering peptide. Multiple transcript variants encoding different isoforms have been found for this gene.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids CGNLSTCMLGTYTQDLNKFHTFPQTSIGVEAP were used as the immunogen for the Calcitonin antibody.
Limitation:
This Calcitonin antibody is available for research use only.
Purity:
Antigen affinity
Species Reactivity :
Mouse, Rat
Uniprot #:
P70160