NSJ Bioreagents

SMC3 Antibody

Product Code:
 
NSJ-RQ4493
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Mouse
Antibody Isotype:
 
Mouse IgG1
Antibody Clonality:
 
Monoclonal
Antibody Clone:
 
4C12
Regulatory Status:
 
RUO
Target Species:
 
Human
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the SMC3 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 4
Western blot testing of human 1) HeLa, 2) A549, 3) MCF7 and 4) MDA-MB-453 lysate with SMC3 antibody at 0.5ug/ml. Predicted molecular weight ~141 kDa.
2 / 4
IHC testing of FFPE human lung cancer with SMC3 antibody at 2ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
3 / 4
IHC testing of FFPE human intestinal cancer with SMC3 antibody at 2ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
4 / 4
Western blot testing of 1) human HeLa, 2) human HEK293, 3) rat thymus and 4) mouse thymus lysate with SMC3 antibody at 0.5ug/ml. Predicted molecular weight ~141 kDa.
❮❯

Western blot testing of human 1) HeLa, 2) A549, 3) MCF7 and 4) MDA-MB-453 lysate with SMC3 antibody at 0.5ug/ml. Predicted molecular weight ~141 kDa.
IHC testing of FFPE human lung cancer with SMC3 antibody at 2ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
IHC testing of FFPE human intestinal cancer with SMC3 antibody at 2ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
Western blot testing of 1) human HeLa, 2) human HEK293, 3) rat thymus and 4) mouse thymus lysate with SMC3 antibody at 0.5ug/ml. Predicted molecular weight ~141 kDa.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-RQ4493-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT
How to order with us   Contact us
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml
Application Note:
Optimal dilution of the SMC3 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
Structural maintenance of chromosomes 3, also known as SMC3, is a human gene. This gene belongs to the SMC3 subfamily of SMC proteins. The encoded protein occurs in certain cell types as either an intracellular, nuclear protein or a secreted protein. The nuclear form, known as structural maintenance of chromosomes 3, is a component of the multimeric cohesin complex that holds together sister chromatids during mitosis, enabling proper chromosome segregation. Post-translational modification of the encoded protein by the addition of chondroitin sulfate chains gives rise to the secreted proteoglycan bamacan, an abundant basement membrane protein.
Format :
Purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids ELLESADKFYGVKFRNKVSHIDVITAEMAKDFVEDDTTH were used as the immunogen for the SMC3 antibody.
Limitation:
This SMC3 antibody is available for research use only.
Localization:
Nucleus
Purity:
Protein G affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
Q9UQE7