NSJ Bioreagents

HSPA2 Antibody

Product Code:
 
NSJ-RQ4498
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Mouse
Antibody Isotype:
 
Mouse IgG1
Antibody Clonality:
 
Monoclonal
Antibody Clone:
 
4A4
Regulatory Status:
 
RUO
Target Species:
 
Human
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the HSPA2 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 2
Western blot testing of human 1) HeLa, 2) MBA-MD-231, 3) COLO-320, 4) PANC-1, 5) HT180, 6) MBA-MD-453 and 7) HepG2 lysate with HSPA2 antibody at 0.5ug/ml. Expected molecular weight ~70 kDa.
2 / 2
IHC testing of FFPE human lung cancer with HSPA2 antibody at 2ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.

Western blot testing of human 1) HeLa, 2) MBA-MD-231, 3) COLO-320, 4) PANC-1, 5) HT180, 6) MBA-MD-453 and 7) HepG2 lysate with HSPA2 antibody at 0.5ug/ml. Expected molecular weight ~70 kDa.
IHC testing of FFPE human lung cancer with HSPA2 antibody at 2ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-RQ4498-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml
Application Note:
Optimal dilution of the HSPA2 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
HSPA2 (heat shock 70kDa protein 2) is also known as HEAT-SHOCK PROTEIN, 70-KD, 2, HSP70-2, HEAT-SHOCK PROTEIN, 70-KD, 3 or HSP70-3. Analysis of the sequence indicated that HSPA2 is the human homolog of the murine Hsp70-2 gene, with 91.7% identity in the nucleotide coding sequence and 98.2% in the corresponding amino acid sequence. HSPA2 has less amino acid homology to the other members of the human HSP70 gene family. HSPA2 is constitutively expressed in most tissues, with very high levels in testis and skeletal muscle. The HSPA2 gene is located on chromosome 14q22-q24. Immunohistochemical analysis detected weak expression of HSPA2 in spermatocytes and stronger expression in spermatids and in the tail of mature sperm. HSPA2 may be critical to sperm maturation through its role as a protein chaperone.
Format :
Purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids KISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHK was used as the immunogen for the HSPA2 antibody.
Limitation:
This HSPA2 antibody is available for research use only.
Localization:
Cytoplasm
Purity:
Protein G affinity
Species Reactivity :
Human
Uniprot #:
P54652