NSJ Bioreagents

Cytokeratin 19 Antibody

Product Code:
 
NSJ-RQ4521
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Mouse
Antibody Isotype:
 
Mouse IgG1
Antibody Clonality:
 
Monoclonal
Antibody Clone:
 
3D4
Regulatory Status:
 
RUO
Target Species:
 
Human
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the Cytokeratin 19 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 3
Immunofluorescent staining of human intestinal cancer with Cytokeratin 19 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
2 / 3
IHC testing of FFPE human intestinal cancer with Cytokeratin 19 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
3 / 3
Western blot testing of human 1) HeLa, 2) placenta, 3) SK-OV-3, 4) COLO-320 and 5) SW620 lysate with Cytokeratin 19 antibody at 0.5ug/ml. Predicted molecular weight ~43 kDa.
❮❯

Immunofluorescent staining of human intestinal cancer with Cytokeratin 19 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
IHC testing of FFPE human intestinal cancer with Cytokeratin 19 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
Western blot testing of human 1) HeLa, 2) placenta, 3) SK-OV-3, 4) COLO-320 and 5) SW620 lysate with Cytokeratin 19 antibody at 0.5ug/ml. Predicted molecular weight ~43 kDa.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-RQ4521-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT
How to order with us   Contact us
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml
Application Note:
Optimal dilution of the Cytokeratin 19 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
Keratin, type I cytoskeletal 19 is a protein that in humans is encoded by the KRT19 gene. The protein encoded by this gene is a member of the keratin family. It is specifically expressed in the periderm, the transiently superficial layer that envelops the developing epidermis. The type I cytokeratins are clustered in a region of chromosome 17q12-q21. Due to its high sensitivity, KRT19 is the most used marker for the RT-PCR-mediated detection of tumor cells disseminated in lymph nodes, peripheral blood, and bone marrow of breast cancer patients. Keratin 19 is often used together with keratin 8 and keratin 18 to differentiate cells of epithelial origin from hematopoietic cells in tests that enumerate circulating tumor cells in blood.
Format :
Purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids QLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSR were used as the immunogen for the Cytokeratin 19 antibody.
Limitation:
This Cytokeratin 19 antibody is available for research use only.
Purity:
Protein G affinity
Species Reactivity :
Human
Uniprot #:
P08727