NSJ Bioreagents

PMEL17 / Melanoma gp100 Antibody

Product Code:
 
NSJ-RQ4546
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Mouse
  • Rat
Application:
 
Western Blot (WB)
Storage:
 
After reconstitution, the PMEL17 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 1
Western blot testing of 1) rat heart and 2) mouse heart lysate with PMEL17 antibody at 0.5ug/ml. Predicted molecular weight: ~70 kDa (unmodified), ~100 kDa (glycosylated).
❮❯

Western blot testing of 1) rat heart and 2) mouse heart lysate with PMEL17 antibody at 0.5ug/ml. Predicted molecular weight: ~70 kDa (unmodified), ~100 kDa (glycosylated).

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-RQ4546-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT
How to order with us   Contact us
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.5-1ug/ml
Application Note:
Optimal dilution of the PMEL17 antibody should be determined by the researcher.
Description:
This gene is mapped to 12q13.2. It encodes a melanocyte-specific type I transmembrane glycoprotein. The encoded protein is enriched in melanosomes, which are the melanin-producing organelles in melanocytes, and plays an essential role in the structural organization of premelanosomes. This protein is involved in generating internal matrix fibers that define the transition from Stage I to Stage II melanosomes. This protein undergoes a complex pattern of prosttranslational processing and modification that is essential to the proper functioning of the protein. A secreted form of this protein that is released by proteolytic ectodomain shedding may be used as a melanoma-specific serum marker. Alternate splicing results in multiple transcript variants.
Format :
Purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids KVPRNQDWLGVSRQLRTKAWNRQLYPEWTEAQRLD were used as the immunogen for the PMEL17 antibody.
Limitation:
This PMEL17 antibody is available for research use only.
Purity:
Antigen affinity purified
Species Reactivity :
Mouse, Rat
Uniprot #:
P40967