NSJ Bioreagents

CD1b Antibody

Product Code:
 
NSJ-RQ4547
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the CD1b antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 3
IHC staining of FFPE human tonsil tissue with CD1b antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
2 / 3
IHC staining of FFPE human tonsil tissue with CD1b antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
3 / 3
Western blot testing of human 1) placenta, 2) PC-3, 3) SW620, 4) THP-1, 5) MDA-MB-231, 6) K562 and 7) A431 lysate with CD1b antibody at 0.5ug/ml. The predicted molecular weight is ~37 kDa but is often observed higher due to glycosylation.

IHC staining of FFPE human tonsil tissue with CD1b antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
IHC staining of FFPE human tonsil tissue with CD1b antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
Western blot testing of human 1) placenta, 2) PC-3, 3) SW620, 4) THP-1, 5) MDA-MB-231, 6) K562 and 7) A431 lysate with CD1b antibody at 0.5ug/ml. The predicted molecular weight is ~37 kDa but is often observed higher due to glycosylation.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-RQ4547-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml
Application Note:
Optimal dilution of the CD1b antibody should be determined by the researcher.
Description:
CD1b is a member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. The human genome contains five CD1 family genes organized in a cluster on chromosome 1. The CD1 family members are thought to differ in their cellular localization and specificity for particular lipid ligands. The protein encoded by this gene localizes to late endosomes and lysosomes via a tyrosine-based motif in the cytoplasmic tail, and requires vesicular acidification to bind lipid antigens.
Format :
Purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids DKEVAELEEIFRVYIFGFAREVQDFAGDFQMKY were used as the immunogen for the CD1b antibody.
Limitation:
This CD1b antibody is available for research use only.
Localization:
Plasma membrane, cytoplasm
Purity:
Antigen affinity purified
Species Reactivity :
Human
Uniprot #:
P29016