NSJ Bioreagents

DHX15 Antibody / Prp43

Product Code:
 
NSJ-RQ5627
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Immunofluorescence (IF)
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution the DHX15 antibody can be stored for up to one month at 4oC. For long-term aliquot and store at -20oC. Avoid repeated freezing and thawing.
1 / 7
Immunofluorescent staining of FFPE human U-2 OS cells with DHX15 antibody (green) and Beta Tubulin mAb (red). HIER: steam section in pH6 citrate buffer for 20 min.
2 / 7
IHC staining of FFPE human prostate cancer tissue with DHX15 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
3 / 7
IHC staining of FFPE human liver cancer tissue with DHX15 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
4 / 7
IHC staining of FFPE human testicular germ cell tumor tissue with DHX15 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
5 / 7
IHC staining of FFPE human colorectal adenocarcinoma tissue with DHX15 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
6 / 7
Western blot testing of 1) human HeLa, 2) human 293T, 3) human Caco-2, 4) human HEL, 5) human RT4, 6) human A549, 7) human A431, 8) human U-251, 9) rat C6 and 10) mouse thymus tissue lysate with DHX15 antibody. Predicted molecular weight ~91 kDa.
7 / 7
Flow cytometry testing of fixed and permeabilized human HeLa cells with DHX15 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= DHX15 antibody.

Immunofluorescent staining of FFPE human U-2 OS cells with DHX15 antibody (green) and Beta Tubulin mAb (red). HIER: steam section in pH6 citrate buffer for 20 min.
IHC staining of FFPE human prostate cancer tissue with DHX15 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human liver cancer tissue with DHX15 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human testicular germ cell tumor tissue with DHX15 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human colorectal adenocarcinoma tissue with DHX15 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Western blot testing of 1) human HeLa, 2) human 293T, 3) human Caco-2, 4) human HEL, 5) human RT4, 6) human A549, 7) human A431, 8) human U-251, 9) rat C6 and 10) mouse thymus tissue lysate with DHX15 antibody. Predicted molecular weight ~91 kDa.
Flow cytometry testing of fixed and permeabilized human HeLa cells with DHX15 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= DHX15 antibody.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-RQ5627-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details:
Western blot: 0.5-1ug/ml,Immunohistochemistry: 2-5ug/ml,Immunofluorescence: 5ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the DHX15 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose
Description:
Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 is an enzyme that in humans is encoded by the DHX15 gene. It is mapped to 4p15.2. The protein encoded by this gene is a putative ATP-dependent RNA helicase implicated in pre-mRNA splicing.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids DIKPEWLVKIAPQYYDMSNFPQCEAKRQLDRIIAKLQSKEYSQY from the human protein were used as the immunogen for the DHX15 antibody.
Limitation:
This DHX15 antibody is available for research use only.
Localization:
Nuclear
Purity:
Affinity purified
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
O43143