NSJ Bioreagents

METTL3 Antibody / M6A

Product Code:
 
NSJ-RQ6198
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
 
Human
Applications:
  • Enzyme-Linked Immunosorbent Assay (ELISA)
  • Fluorescence-activated cell sorting (FACS)
  • Immunofluorescence (IF)
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the METTL3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
1 / 5
IHC staining of FFPE human gastric cancer with METTL3 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
2 / 5
IHC staining of FFPE human ovarian cancer with METTL3 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
3 / 5
Immunofluorescent staining of FFPE human PC-3 cells with METTL3 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
4 / 5
Western blot testing of human 1) PC-3, 2) HepG2, 3) A549, 4) HEK293, 5) HeLa, 6) Caco-2 and 7) K562 cell lysate with METTL3 antibody. Predicted molecular weight ~75 kDa.
5 / 5
Flow cytometry testing of human ThP-1 cells with METTL3 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= METTL3 antibody.

IHC staining of FFPE human gastric cancer with METTL3 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human ovarian cancer with METTL3 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Immunofluorescent staining of FFPE human PC-3 cells with METTL3 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Western blot testing of human 1) PC-3, 2) HepG2, 3) A549, 4) HEK293, 5) HeLa, 6) Caco-2 and 7) K562 cell lysate with METTL3 antibody. Predicted molecular weight ~75 kDa.
Flow cytometry testing of human ThP-1 cells with METTL3 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= METTL3 antibody.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-RQ6198-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 1-2ug/ml,Flow cytometry: 1-3ug/million cells,Immunohistochemistry (FFPE): 2-5ug/ml,Immunofluorescence: 5ug/ml,Direct ELISA: 0.1-0.5ug/ml
Application Note:
Optimal dilution of the METTL3 antibody should be determined by the researcher.
Description:
N6-adenosine-methyltransferase 70 kDa subunit (METTL3) is an enzyme that in humans is encoded by the METTL3 gene. It is mapped to 14q11.2. This gene encodes the 70 kDa subunit of MT-A which is part of N6-adenosine-methyltransferase. This enzyme is involved in the posttranscriptional methylation of internal adenosine residues in eukaryotic mRNAs, forming N6-methyladenosine.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids HNVQPNWITLGNQLDGIHLLDPDVVARFKQRYPDGIISKPKNL from the human protein were used as the immunogen for the METTL3 antibody.
Limitation:
This METTL3 antibody is available for research use only.
Localization:
Cytoplasmic, nuclear
Purity:
Affinity purified
Species Reactivity :
Human
Uniprot #:
Q86U44