NSJ Bioreagents

PGP9.5 / UchL1 Antibody

Product Code:
 
NSJ-RQ6534
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Mouse
Antibody Isotype:
 
Mouse IgG1
Antibody Clonality:
 
Monoclonal
Antibody Clone:
 
3.00E+04
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the PGP9.5 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
1 / 4
IHC staining of FFPE human renal clear cell carcinoma tissue with PGP9.5 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
2 / 4
IHC staining of FFPE rat brain tissue with PGP9.5 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
3 / 4
Western blot testing of 1) human U-87 MG, 2) human SH-SY5Y, 3) rat brain and 4) mouse brain lysate with PGP9.5 antibody. Predicted molecular weight ~25 kDa.
4 / 4
Flow cytometry testing of human 293T cells with PGP9.5 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= PGP9.5 antibody.

IHC staining of FFPE human renal clear cell carcinoma tissue with PGP9.5 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE rat brain tissue with PGP9.5 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Western blot testing of 1) human U-87 MG, 2) human SH-SY5Y, 3) rat brain and 4) mouse brain lysate with PGP9.5 antibody. Predicted molecular weight ~25 kDa.
Flow cytometry testing of human 293T cells with PGP9.5 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= PGP9.5 antibody.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-RQ6534-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 1-2ug/ml,Immunohistochemistry (FFPE): 2-5ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the PGP9.5 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose
Description:
UCH-L1, also known as PGP9.5, is a member of a gene family whose products hydrolyze small C-terminal adducts of ubiquitin to generate the ubiquitin monomer. Expression of UCH-L1 is highly specific to neurons and to cells of the diffuse neuroendocrine system and their tumors. It is abundantly present in all neurons (accounts for 1-2% of total brain protein), expressed specifically in neurons and testis/ovary. The catalytic triad of UCH-L1 contains a cysteine at position 90, an aspartate at position 176, and a histidine at position 161 that are responsible for its hydrolase activity.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids 120-153 (ETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCR) were used as the immunogen for the PGP9.5 antibody.
Limitation:
This PGP9.5 antibody is available for research use only.
Localization:
Cytoplasmic, ER membrane
Purity:
Affinity purified
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
P09936