NSJ Bioreagents

TCF-8 Antibody / ZEB1 / AREB6

Product Code:
 
NSJ-RQ7307
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Mouse
Antibody Isotype:
 
Mouse IgG2b
Antibody Clonality:
 
Monoclonal
Antibody Clone:
 
8B12D1
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the TCF-8 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
1 / 12
IHC staining of FFPE human testicular germ cell tumor tissue with TCF-8 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
2 / 12
IHC staining of FFPE human thyroid cancer tissue with TCF-8 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
3 / 12
IHC staining of FFPE human glioblastoma tissue with TCF-8 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
4 / 12
IHC staining of FFPE human breast cancer tissue with TCF-8 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
5 / 12
IHC staining of FFPE human laryngeal squamous cell carcinoma tissue with TCF-8 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
6 / 12
IHC staining of FFPE human lung adenocarcinoma tissue with TCF-8 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
7 / 12
IHC staining of FFPE human colorectal adenocarcinoma tissue with TCF-8 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
8 / 12
IHC staining of FFPE mouse brain tissue with TCF-8 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
9 / 12
IHC staining of FFPE rat brain tissue with TCF-8 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
10 / 12
Immunofluorescent staining of FFPE human glioma tissue with TCF-8 antibody. HIER: steam section in pH8 EDTA buffer for 20 min.
11 / 12
Immunofluorescent staining of FFPE human U-87 MG cells with TCF-8 antibody. HIER: steam section in pH6 citrate buffer for 20 min.
12 / 12
Western blot testing of 1) human U-87 MG, 2) rat brain, 3) mouse brain and 4) mouse lung tissue lysate with TCF-8 antibody. Predicted molecular weight ~124 kDa but observed at up to ~200 kDa.
❮❯

IHC staining of FFPE human testicular germ cell tumor tissue with TCF-8 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human thyroid cancer tissue with TCF-8 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human glioblastoma tissue with TCF-8 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human breast cancer tissue with TCF-8 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human laryngeal squamous cell carcinoma tissue with TCF-8 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human lung adenocarcinoma tissue with TCF-8 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human colorectal adenocarcinoma tissue with TCF-8 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE mouse brain tissue with TCF-8 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE rat brain tissue with TCF-8 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Immunofluorescent staining of FFPE human glioma tissue with TCF-8 antibody. HIER: steam section in pH8 EDTA buffer for 20 min.
Immunofluorescent staining of FFPE human U-87 MG cells with TCF-8 antibody. HIER: steam section in pH6 citrate buffer for 20 min.
Western blot testing of 1) human U-87 MG, 2) rat brain, 3) mouse brain and 4) mouse lung tissue lysate with TCF-8 antibody. Predicted molecular weight ~124 kDa but observed at up to ~200 kDa.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-RQ7307-100UG100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
How to order with us   Contact us
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details:
Western blot: 0.5-1ug/ml, Immunohistochemistry (FFPE): 2-5ug/ml
Application Note:
Optimal dilution of the TCF-8 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose
Description:
ZEB1 (Zinc Finger E Box-Binding Homeobox 1), also called TCF8, AREB6, NIL2A or DELTA-EF1, is a protein that in humans is encoded by the ZEB1 gene. Fluorescence in situ hybridization localized the ZEB1 gene to chromosome 10p11.2. Krafchak et al. (2005) demonstrated a complex (core plus secondary) binding site for TCF8 in the promoter of the COL4A3 gene, mutant in Alport syndrome and which encodes collagen type IV alpha-3. They detected expression of TCF8 in cornea. Nishimura et al. (2006) found that delta-Ef1 was upregulated during differentiation in a mouse smooth muscle cell (SMC) line.
Format:
Antigen affinity purified
Formulation:
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids LLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQ were used as the immunogen for the TCF-8 antibody.
Limitation:
This TCF-8 antibody is available for research use only.
Localization:
Nuclear
Purity:
Antigen affinity purified
Uniprot #:
P37275

Documents