[KD Validated] Proprotein Convertase 9(PCSK9) Rabbit mAb

WB,1:500 - 1:1000

This gene encodes a member of the subtilisin-like proprotein convertase family, which includes proteases that process Protein A Affinity purificationnd peptide precursors trafficking through regulated or constitutive branches of the secretory pathway. The encoded protein undergoes an autocatalytic processing event with its prosegment in the ER and is constitutively secreted as an inactive protease into the extracellular matrix and trans-Golgi network. It is expressed in liver, intestine and kidney tissues and escorts specific receptors for lysosomal degradation. It plays a role in cholesterol and fatty acid metabolism. Mutations in this gene have been associated with autosomal dominant familial hypercholesterolemia. Alternative splicing results in multiple transcript variants.

Unconjugated

PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol

PCSK9

255738

255738

A synthetic peptide corresponding to a sequence within amino acids 593-692 of human Proprotein Convertase 9(PCSK9) (NP_777596.2).

74kDa

EASIHASCCHAPGLECKVKEHGIPAPQEQVTVACEEGWTLTGCSALPGTSHVLGAYAVDNTCVVRSRDVSTTGSTSEGAVTAVAICCRSRHLAQASQELQ