UBQLN1 Rabbit pAb

WB,1:200 - 1:2000

This gene encodes an ubiquitin-like protein (ubiquilin) that shares a high degree of similarity with related products in yeast, rat and frog. Ubiquilins contain an N-terminal ubiquitin-like domain and a C-terminal ubiquitin-associated domain. They physically associate with both proteasomes and ubiquitin ligases, and thus are thought to functionally link the ubiquitination machinery to the proteasome to affect in vivo protein degradation. This ubiquilin has also been shown to modulate accumulation of presenilin proteins, and it is found in lesions associated with Alzheimer's and Parkinson's disease. Two transcript variants encoding different isoforms have been found for this gene.

Unconjugated

PBS with 0.01% thimerosal, 50% glycerol

UBQLN1

29979

29979

Recombinant fusion protein containing a sequence corresponding to amino acids 480-540 of human UBQLN1 (NP_038466.2).

63kDa

LIPGFTPGLGALGSTGGSSGTNGSNATPSENTSPTAGTTEPGHQQFIQQMLQALAGVNPQL