[KO Validated] APP Rabbit mAb

WB,1:500 - 1:2000 | IHC-P,1:50 - 1:200 | IF/ICC,1:50 - 1:200 | IP,1:500 - 1:1000

This gene encodes a cell surface receptor and transmembrane precursor protein that is cleaved by secretases to form a number of peptides. Some of these peptides are secreted and can bind to the acetyltransferase complex APBB1/TIP60 to promote transcriptional activation, while others form the protein basis of the amyloid plaques found in the brains of patients with Alzheimer disease. In addition, two of the peptides are antimicrobial peptides, having been shown to have bacteriocidal and antifungal activities. Mutations in this gene have been implicated in autosomal dominant Alzheimer disease and cerebroarterial amyloidosis (cerebral amyloid angiopathy). Multiple transcript variants encoding several different isoforms have been found for this gene.

Unconjugated

PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol

APP

351

351

A synthetic peptide corresponding to a sequence within amino acids 671-770 of human APP (P05067).

87kDa

MDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN