APC Rabbit mAb

WB,1:500 - 1:2000 | IP,1:100 - 1:500

This gene encodes a tumor suppressor protein that acts as an antagonist of the Wnt signaling pathway. It is also involved in other processes including cell migration and adhesion, transcriptional activation, and apoptosis. Defects in this gene cause familial adenomatous polyposis (FAP), an autosomal dominant pre-malignant disease that usually progresses to malignancy. Mutations in the APC gene have been found to occur in most colorectal cancers, where disease-associated mutations tend to be clustered in a small region designated the mutation cluster region (MCR) and result in a truncated protein product.

Unconjugated

PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol

APC

324

324

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human APC (NP_000029.2).

312kDa

MAAASYDQLLKQVEALKMENSNLRQELEDNSNHLTKLETEASNMKEVLKQLQGSIEDEAMASSGQIDLLERLKELNLDSSNFPGVKLRSKMSLRSYGSRE