ANGPT1 Rabbit mAb

WB,1:500 - 1:1000 | IHC-P,1:50 - 1:200

This gene encodes a secreted glycoprotein that belongs to the angiopoietin family. Members of this family play important roles in vascular development and angiogenesis. All angiopoietins bind with similar affinity to an endothelial cell-specific tyrosine-protein kinase receptor. The protein encoded by this gene is a secreted glycoprotein that activates the receptor by inducing its tyrosine phosphorylation. It plays a critical role in mediating reciprocal interactions between the endothelium and surrounding matrix and mesenchyme and inhibits endothelial permeability. The Protein A Affinity purificationlso contributes to blood vessel maturation and stability, and may be involved in early development of the heart. Mutations in this gene are associated with hereditary angioedema.

Unconjugated

PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol

A synthetic peptide corresponding to a sequence within amino acids 200-300 of human ANGPT1 (Q15389).

58kDa

EMEGKHKEELDTLKEEKENLQGLVTRQTYIIQELEKQLNRATTNNSVLQKQQLELMDTVHNLVNLCTKEGVLLKGGKREEEKPFRDCADVYQAGFNKSGIY