IGFBP7 Rabbit mAb

WB,1:500 - 1:2000 | IF/ICC,1:50 - 1:200

This gene encodes a member of the insulin-like growth factor (IGF)-binding protein (IGFBP) family. IGFBPs bind IGFs with high affinity, and regulate IGF availability in body fluids and tissues and modulate IGF binding to its receptors. This protein binds IGF-I and IGF-II with relatively low affinity, and belongs to a subfamily of low-affinity IGFBPs. It also stimulates prostacyclin production and cell adhesion. Alternatively spliced transcript variants encoding different isoforms have been described for this gene, and one variant has been associated with retinal arterial macroaneurysm (PMID:21835307).

Unconjugated

PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol

A synthetic peptide corresponding to a sequence within amino acids 50-150 of human IGFBP7 (Q16270).

29kDa

LGETRDACGCCPMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVCGSDGTTYPSGCQLRAASQRAESRGEKAITQ