NSJ Bioreagents

AGER Antibody / RAGE

Product Code:
 
NSJ-RQ7676
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Mouse
Antibody Isotype:
 
Mouse IgG2b
Antibody Clonality:
 
Monoclonal
Antibody Clone:
 
5C6C1
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the AGER antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
1 / 5
IHC staining of FFPE mouse lung tissue with AGER antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
2 / 5
IHC staining of FFPE rat lung tissue with AGER antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
3 / 5
IHC staining of FFPE rat lung tissue with AGER antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
4 / 5
Western blot testing of 1) rat lung and 2) mouse lung tissue lysate with AGER antibody. Predicted molecular weight ~43 kDa.
5 / 5
Flow cytometry testing of human Jurkat cells with AGER antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= AGER antibody.
❮❯

IHC staining of FFPE mouse lung tissue with AGER antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE rat lung tissue with AGER antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE rat lung tissue with AGER antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Western blot testing of 1) rat lung and 2) mouse lung tissue lysate with AGER antibody. Predicted molecular weight ~43 kDa.
Flow cytometry testing of human Jurkat cells with AGER antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= AGER antibody.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-RQ7676-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
How to order with us   Contact us
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Show All

Further Information

Application Details:
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 2-5ug/ml,Flow cytometry: 1-3ug/million cells
Buffer:
Lyophilized from 1X PBS with 2% Trehalose
Description:
The receptor for advanced glycation end products (RAGE) is a multi-ligand member of the immunoglobulin superfamily of cell surface molecules. It interacts with distinct molecules implicated in homeostasis, development and inflammation, and certain diseases such as diabetes and Alzheimer's disease. RAGE is also a central cell surface receptor for amphoterin and EN-RAGE. And RAGE is associated with sustained NF-kappaB activation in the diabetic microenvironment and has a central role in sensory neuronal dysfunction. Moreover, RAGE propagates cellular dysfunction in several inflammatory disorders and diabetes, and it also functions as an endothelial adhesion receptor promoting leukocyte recruitment.
Format:
Antigen affinity purified
Formulation:
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids 91-120 (IQDEGIFRCQAMNRNGKETKSNYRVRVYQI) from the human protein were used as the immunogen for the AGER antibody.
Purity:
Antigen affinity purified
Uniprot #:
Q15109