Mouse anti Integrin alpha 3B
Antibody Clonality:
Monoclonal
Applications:- Immunocytochemistry (ICC)
- Immunohistochemistry (IHC)
- Western Blot (WB)
Storage:
Store at 4°C or in small aliquots at -20°C.
No additional charges, what you see is what you pay! *
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available!
Contact us to find what you can save.
This product comes from:
Netherlands.
Typical lead time:
7-10 working days.
Contact us for more accurate information.
- Further Information
- Documents
- References
- Show All
Further Information
Applications Description:
54B3 is suitable for immunoblotting, immunocytochemistry and immunohistochemistry on frozen tissues. Optimal antibody dilution should be determined by titration; recommended range is 1:25 ? 1:200 for immunohistochemistry with avidin-biotinylated Horseradish peroxidase complex (ABC) as detection reagent, and 1:100 ? 1:1000 for immunoblotting applications.
Integrins are a family of heterodimeric membrane glycoproteins consisting of non-covalently associated ? and ? subunits. More than 18 ? and 8 ? subunits with numerous splice variant isoforms have been identified in mammals. In general, integrins function as receptors for extracellular matrix proteins. Certain integrins can also bind to soluble ligands or to counter-receptors on adjacent cells, such as the intracellular adhesion molecules (ICAMs), resulting in aggregation of cells. Signals transduced by integrins play a role in many biological processes, including cell growth, differentiation, migRation and apoptosis. For integrin subunits ?3 and ?6, two cytoplasmic variants, A and B, have been identified.
This product is intended FOR RESEARCH USE ONLY, and FOR TESTS IN VITRO, not for use in diagnostic or therapeutic procedures involving humans or animals.
This product contains sodium azide. To prevent formation of toxic vapors, do not mix with strong acidic solutions. To prevent formation of potentially explosive metallic azides in metal plumbing, always wash into drain with copious quantities of water.
This datasheet is as accurate as reasonably achievable, but Nordic-MUbio accepts no liability for any inaccuracies or omissions in this information.
Cancer|Cell adhesion
Each vial contains 100 ul 1 mg/ml purified monoclonal antibody in PBS containing 0.09% sodium azide.
Each vial contains 100 ul 1 mg/ml purified monoclonal antibody in PBS containing 0.09% sodium azide.
54B3 is a Mouse monoclonal IgG1 antibody derived by fusion of SP2/0 Mouse myeloma cells with spleen cells from a BALB/c Mouse immunized with a synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of integrin ?3B including an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to keyhole limpet hemocyanin.
A broad species reactivity is expected because of the conserved nature of the epitope.
54B3 recognizes specifically the cytoplasmic domain of integrin subunit ?3B which is present in microvascular structures in brain and heart.
P26006