NSJ Bioreagents

ARHGEF1 Antibody

Product Code:
 
NSJ-R32513
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the ARHGEF1 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 5
Immunofluorescent staining of FFPE human A431 cells with ARHGEF1 antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
2 / 5
IHC testing of FFPE mouse lymph tissue with ARHGEF1 antibody at 1ug/ml. HIER: steam sections in pH6 citrate buffer for 20 min.
3 / 5
IHC testing of FFPE rat lymph tissue with ARHGEF1 antibody at 1ug/ml. HIER: steam sections in pH6 citrate buffer for 20 min.
4 / 5
Western blot testing of 1) rat brain, 2) human HeLa and 3) human Jurkat lysate with ARHGEF1 antibody at 0.5ug/ml. Predicted molecular weight ~102 kDa, but routinely observed at ~115 kDa.
5 / 5
Flow cytometry testing of human A431 cells with ARHGEF1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= ARHGEF1 antibody.

Immunofluorescent staining of FFPE human A431 cells with ARHGEF1 antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
IHC testing of FFPE mouse lymph tissue with ARHGEF1 antibody at 1ug/ml. HIER: steam sections in pH6 citrate buffer for 20 min.
IHC testing of FFPE rat lymph tissue with ARHGEF1 antibody at 1ug/ml. HIER: steam sections in pH6 citrate buffer for 20 min.
Western blot testing of 1) rat brain, 2) human HeLa and 3) human Jurkat lysate with ARHGEF1 antibody at 0.5ug/ml. Predicted molecular weight ~102 kDa, but routinely observed at ~115 kDa.
Flow cytometry testing of human A431 cells with ARHGEF1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= ARHGEF1 antibody.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R32513-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml,Immunofluorescence (FFPE): 2-4ug/ml,Flow cytometry: 1-3ug/million cells
Buffer:
Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
Description:
Rho guanine nucleotide exchange factor 1, also called p115-RhoGEF, is a protein that in humans is encoded by the ARHGEF1 gene. Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein coupled receptors. The encoded protein may form a complex with G proteins and stimulate Rho-dependent signals. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids 41-71 (EQNSQFQSLEQVKRRPAHLMALLQHVALQFE) from the human protein were used as the immunogen for the ARHGEF1 antibody.
Limitation:
This ARHGEF1 antibody is available for research use only.
Localization:
Cytoplasmic, membranous
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
Q92888