NSJ Bioreagents

Ataxin-2 Antibody / ATXN2

Product Code:
 
NSJ-R32313
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the ATX2 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 5
IHC staining of FFPE human glioma tissue with ATX2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
2 / 5
IHC staining of FFPE human placenta tissue with ATX2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
3 / 5
IHC staining of FFPE human colonic adenoma cancer tissue with ATX2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
4 / 5
IHC staining of FFPE human breast cancer tissue with ATX2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
5 / 5
Western blot testing of human 1) HeLa, 2) K562, 3) A549, 4) rat brain, 5) mouse brain, and 6) mouse liver tissue lysate with ATX2 antibody. Expected molecular weight: 114~140 kDa.

IHC staining of FFPE human glioma tissue with ATX2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human placenta tissue with ATX2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human colonic adenoma cancer tissue with ATX2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human breast cancer tissue with ATX2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Western blot testing of human 1) HeLa, 2) K562, 3) A549, 4) rat brain, 5) mouse brain, and 6) mouse liver tissue lysate with ATX2 antibody. Expected molecular weight: 114~140 kDa.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R32313-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 2-5ug/ml
Application Note:
Optimal dilution of the ATX2 antibody should be determined by the researcher.
Description:
Ataxin-2, or ATX2, protein is encoded by the ATXN2 gene and contains a polyglutamine tract, long expansions (greater than 33 repeats) of which result in spinocerebellar ataxia-2 (SCA2), an autosomal dominant form of olivopontocerebellar atrophy. The gene for spinocerebellar ataxia type 2 (SCA2) has been mapped to 12q24.1. Ataxin-2 associates with L- and T-plastin and that overexpression of ataxin-2 leads to accumulation of T-plastin in mammalian cells.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids QSALQPIPVSTTAHFPYMTHPSVQAHHQQQL of human ATXN2 were used as the immunogen for the ATX2 antibody.
Limitation:
This ATX2 antibody is available for research use only.
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
Q99700