NSJ Bioreagents

ATG14L Antibody

Product Code:
 
NSJ-R32270
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Rat
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the ATG14L antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 10
Western blot testing of 1) rat brain and 2) human HeLa lysate with ATG14L antibody. Expected/observed molecular weight ~59 kDa.
2 / 10
IHC testing of FFPE human lung cancer tissue with ATG14L antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
3 / 10
IHC testing of FFPE rat spleen with ATG14L antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
4 / 10
Flow cytometry testing of human A431 cells with ATG14L antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= ATG14L antibody.
5 / 10
Flow cytometry testing of human SiHa cells with ATG14L antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= ATG14L antibody.
6 / 10
Flow cytometry testing of human PC-3 cells with ATG14L antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= ATG14L antibody.
7 / 10
Immunofluorescent staining of FFPE human U-2 OS cells with ATG14L antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
8 / 10
Immunofluorescent staining of FFPE human lung cancer tissue with ATG14L antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH8 EDTA buffer for 20 min.
9 / 10
Immunofluorescent staining of FFPE human colon cancer tissue with ATG14L antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH8 EDTA buffer for 20 min.
10 / 10
Immunofluorescent staining of FFPE rat spleen tissue with ATG14L antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH8 EDTA buffer for 20 min.

Western blot testing of 1) rat brain and 2) human HeLa lysate with ATG14L antibody. Expected/observed molecular weight ~59 kDa.
IHC testing of FFPE human lung cancer tissue with ATG14L antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE rat spleen with ATG14L antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
Flow cytometry testing of human A431 cells with ATG14L antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= ATG14L antibody.
Flow cytometry testing of human SiHa cells with ATG14L antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= ATG14L antibody.
Flow cytometry testing of human PC-3 cells with ATG14L antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= ATG14L antibody.
Immunofluorescent staining of FFPE human U-2 OS cells with ATG14L antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Immunofluorescent staining of FFPE human lung cancer tissue with ATG14L antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH8 EDTA buffer for 20 min.
Immunofluorescent staining of FFPE human colon cancer tissue with ATG14L antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH8 EDTA buffer for 20 min.
Immunofluorescent staining of FFPE rat spleen tissue with ATG14L antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH8 EDTA buffer for 20 min.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R32270-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml,Immunohistochemistry (FFPE): 0.5-1ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the ATG14L antibody should be determined by the researcher.
Description:
ATG14 (also known as beclin-1-associated autophagy-related key regulator (Barkor) or ATG14L), an essential autophagy-specific regulator of the class III phosphatidylinositol 3-kinase complex, promotes membrane tethering of protein-free liposomes, and enhances hemifusion and full fusion of proteoliposomes reconstituted with the target (t)-SNAREs (soluble N-ethylmaleimide-sensitive factor attachment protein receptors) syntaxin 17 (STX17) and SNAP29, and the vesicle (v)-SNARE VAMP8 (vesicle-associated membrane protein 8). ATG14 binds to the SNARE core domain of STX17 through its coiled-coil domain, and stabilizes the STX17-SNAP29 binary t-SNARE complex on autophagosomes.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids RDRERFIDKKERLSRLKSKQEEFQKEVLKAME of human ATG14L were used as the immunogen for the ATG14L antibody.
Limitation:
This ATG14L antibody is available for research use only.
Localization:
Cytoplasmic
Purity:
Antigen affinity
Species Reactivity :
Human, Rat
Uniprot #:
Q6ZNE5