NSJ Bioreagents

CCR3 Antibody

Product Code:
 
NSJ-RQ4331
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Western Blot (WB)
Storage:
 
After reconstitution, the CCR3 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 2
Western blot testing of human 1) Jurkat, 2) HepG2, 3) MCF7, 4) U-87 MG, 5) CCRF-CEM, 6) rat brain, 7) mouse brain and 8) mouse testis lysate wtih CCR3 antibody at 0.5ug/ml. Expected molecular weight: 40~55 kDa.
2 / 2
Flow cytometry testing of mouse RAW264.7 cells with CCR3 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=CCR3 antibody.

Western blot testing of human 1) Jurkat, 2) HepG2, 3) MCF7, 4) U-87 MG, 5) CCRF-CEM, 6) rat brain, 7) mouse brain and 8) mouse testis lysate wtih CCR3 antibody at 0.5ug/ml. Expected molecular weight: 40~55 kDa.
Flow cytometry testing of mouse RAW264.7 cells with CCR3 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=CCR3 antibody.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-RQ4331-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the CCR3 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
C-C chemokine receptor type 3, also called CCR3 or CKR3 is a protein that in humans is encoded by the CCR3 gene. The protein encoded by this gene is a receptor for C-C type chemokines. It belongs to family 1 of the G protein-coupled receptors. This gene and seven other chemokine receptor genes form a chemokine receptor gene cluster on the chromosomal region 3p21. This receptor binds and responds to a variety of chemokines, including eotaxin (CCL11), eotaxin-3 (CCL26), MCP-3 (CCL7), MCP-4 (CCL13), and RANTES (CCL5). It is highly expressed in eosinophils and basophils, and is also detected in TH1 and TH2 cells, as well as in airway epithelial cells. This receptor may contribute to the accumulation and activation of eosinophils and other inflammatory cells in the allergic airway. It is also known to be an entry co-receptor for HIV-1. Alternatively spliced transcript variants have been described.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids MTTSLDTVETFGTTSYYDDVGLLCEKADTRALMA were used as the immunogen for the CCR3 antibody.
Limitation:
This CCR3 antibody is available for research use only.
Localization:
Cell membrane
Purity:
Antigen affinity purified
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
P51677