NSJ Bioreagents

DDAH1 Antibody

Product Code:
 
NSJ-R32437
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Application:
 
Western Blot (WB)
Storage:
 
Prior to reconstitution, store at 40. After reconstitution, the DDAH1 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 5
Western blot testing of 1) rat kidney, 2) mouse kidney and 3) human HeLa lysate with DDAH1 antibody at 0.5ug/ml. Expected molecular weight: ~31 kDa.
2 / 5
IHC staining of FFPE mosue brain with DDAH1 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
3 / 5
IHC staining of FFPE rat brain with DDAH1 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
4 / 5
Flow cytometry testing of human A431 cells with DDAH1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= DDAH1 antibody.
5 / 5
Immunofluorescent staining of FFPE human U-2 OS cells with DDAH1 antibody (red) and DAPI nuclear stain (blue). HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.

Western blot testing of 1) rat kidney, 2) mouse kidney and 3) human HeLa lysate with DDAH1 antibody at 0.5ug/ml. Expected molecular weight: ~31 kDa.
IHC staining of FFPE mosue brain with DDAH1 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
IHC staining of FFPE rat brain with DDAH1 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
Flow cytometry testing of human A431 cells with DDAH1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= DDAH1 antibody.
Immunofluorescent staining of FFPE human U-2 OS cells with DDAH1 antibody (red) and DAPI nuclear stain (blue). HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R32437-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.5-1ug/ml (mouse/rat); 2-4ug/ml (human),Immunohistochemistry (FFPE): 1-2ug/ml,Flow cytometry: 1-3ug/million cells,Immunofluorescence: 2-4ug/ml
Buffer:
Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
Description:
DDAH1 is knowns as dimethylarginine dimethylaminohydrolase 1 which is mapped to chromosome 1p22 by radiation hybrid and FISH analysis. This gene belongs to the dimethylarginine dimethylaminohydrolase (DDAH) gene family. DDAH1 plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity. It widely expressed, especially in liver and kidney.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids QKALKIMQQMSDHRYDKLTVPDDIAANCIYLN were used as the immunogen for the DDAH1 antibody.
Limitation:
This DDAH1 antibody is available for research use only.
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
O94760