NSJ Bioreagents

DDAH2 Antibody

Product Code:
 
NSJ-R32438
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
Prior to reconstitution, store at 40. After reconstitution, the DDAH2 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 5
Immunofluorescent staining of FFPE human U-2 OS cells with DDAH2 antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
2 / 5
IHC testing of FFPE human lung cancer tissue with DDAH2 antibody at 1ug/ml. HIER: steam in pH6 citrate buffer and allow to cool prior to staining.
3 / 5
IHC testing of FFPE human placenta with DDAH2 antibody at 1ug/ml. HIER: steam in pH6 citrate buffer and allow to cool prior to staining.
4 / 5
Flow cytometry testing of human Caco-2 cells with DDAH2 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= DDAH2 antibody.
5 / 5
Western blot testing of 1) rat lung, 2) mouse lung and 3) human placenta lysate with DDAH2 antibody at 0.5ug/ml. Expected molecular weight ~29 kDa.

Immunofluorescent staining of FFPE human U-2 OS cells with DDAH2 antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
IHC testing of FFPE human lung cancer tissue with DDAH2 antibody at 1ug/ml. HIER: steam in pH6 citrate buffer and allow to cool prior to staining.
IHC testing of FFPE human placenta with DDAH2 antibody at 1ug/ml. HIER: steam in pH6 citrate buffer and allow to cool prior to staining.
Flow cytometry testing of human Caco-2 cells with DDAH2 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= DDAH2 antibody.
Western blot testing of 1) rat lung, 2) mouse lung and 3) human placenta lysate with DDAH2 antibody at 0.5ug/ml. Expected molecular weight ~29 kDa.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R32438-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml,Immunofluorescence (FFPE): 2-4ug/ml,Flow cytometry: 1-3ug/million cells
Buffer:
Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
Description:
DDAH2 is known as dimethylarginine dimethylaminohydrolase 2 which is mapped to 6p21.3 by radiation hybrid and FISH analysis. This gene encodes a dimethylarginine dimethylaminohydrolase. DDAH2 functions in nitric oxide generation by regulating the cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity. The protein may be localized to the mitochondria. Alternative splicing resulting in multiple transcript variants.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids DAAQKAVRAMAVLTDHPYASLTLPDDAAADCLFLR were used as the immunogen for the DDAH2 antibody.
Limitation:
This DDAH2 antibody is available for research use only.
Localization:
Cytoplasmic, membranous
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
O95865