NSJ Bioreagents

E2F4 Antibody

Product Code:
 
NSJ-R32525
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the E2F4 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 4
Western blot testing of human 1) HeLa, 2) U-2 OS and 3) MCF7 lysate with E2F4 antibody at 0.5ug/ml. Expected molecular weight ~44 kDa (unmodified) and 60-65 kDa (phosphorylated).
2 / 4
IHC testing of FFPE human intestinal cancer tissue with E2F4 antibody at 1ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
3 / 4
IHC testing of FFPE mouse intestine with E2F4 antibody at 1ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
4 / 4
IHC testing of FFPE rat intestine with E2F4 antibody at 1ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.

Western blot testing of human 1) HeLa, 2) U-2 OS and 3) MCF7 lysate with E2F4 antibody at 0.5ug/ml. Expected molecular weight ~44 kDa (unmodified) and 60-65 kDa (phosphorylated).
IHC testing of FFPE human intestinal cancer tissue with E2F4 antibody at 1ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
IHC testing of FFPE mouse intestine with E2F4 antibody at 1ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
IHC testing of FFPE rat intestine with E2F4 antibody at 1ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R32525-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml
Buffer:
Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
Description:
E2F4 is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. This protein binds to all three of the tumor suppressor proteins pRB, p107 and p130, but with higher affinity to the last two.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids 106-144 (ELQQREQELDQHKVWVQQSIRNVTEDVQNSCLAYVTHED) from the human protein were used as the immunogen for the E2F4 antibody.
Limitation:
This E2F4 antibody is available for research use only.
Localization:
Cytoplasmic, nuclear
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
Q16254