NSJ Bioreagents

FABP5 Antibody (epidermal)

Product Code:
 
NSJ-RQ4416
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunofluorescence (IF)
  • Western Blot (WB)
Storage:
 
After reconstitution the FABP5 antibody can be stored for up to one month at 40. For long-term aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 4
Immunofluorescent staining of FFPE human U-2 OS cells with FABP5 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
2 / 4
Immunofluorescent staining of FFPE human A549 cells with FABP5 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
3 / 4
Western blot testing of 1) human HeLa, 2) human A549, 3) rat thymus and 4) mouse thymus lysate with FABP5 antibody at 0.5ug/ml. Predicted molecular weight ~15 kDa.
4 / 4
Western blot testing of 1) human RT4, 2) human PC-3, 3) rat lung and 4) mouse lung tissue lysate with FABP5 antibody at 0.5ug/ml. Predicted molecular weight ~15 kDa.
❮❯

Immunofluorescent staining of FFPE human U-2 OS cells with FABP5 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Immunofluorescent staining of FFPE human A549 cells with FABP5 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Western blot testing of 1) human HeLa, 2) human A549, 3) rat thymus and 4) mouse thymus lysate with FABP5 antibody at 0.5ug/ml. Predicted molecular weight ~15 kDa.
Western blot testing of 1) human RT4, 2) human PC-3, 3) rat lung and 4) mouse lung tissue lysate with FABP5 antibody at 0.5ug/ml. Predicted molecular weight ~15 kDa.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-RQ4416-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
How to order with us   Contact us
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details:
Western blot: 0.5-1ug/ml,Immunofluorescence: 5ug/ml
Application Note:
Optimal dilution of the FABP5 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose
Description:
FABP5, Fatty acid-binding protein, epidermal, is a protein that in humans is encoded by the FABP5 gene. This gene encodes the fatty acid binding protein found in epidermal cells, and was first identified as being upregulated in psoriasis tissue. It is mapped to 8q21.13. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids KWRLMESHGFEEYMKELGVGLALRKMAAMAKPD from the human protein were used as the immunogen for the FABP5 antibody.
Limitation:
This FABP5 antibody is available for research use only.
Localization:
Cytoplasmic, nuclear
Purity:
Antigen affinity purified
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
Q01469