NSJ Bioreagents

GAL4 Antibody / Galectin-4

Product Code:
 
NSJ-R32387
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
 
Human
Application:
 
Western Blot (WB)
Storage:
 
After reconstitution, the GAL4 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 3
Western blot testing of human 1) SW620 and 2) COLO320 cell lysate with GAL4 antibody. Expected molecular weight ~36 kDa.
2 / 3
IF/ICC staining of FFPE human A431 cells with GAL4 antibody (green) at 2ug/ml and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
3 / 3
Flow cytometry testing of human ThP1 cells with GAL4 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= GAL4 antibody.

Western blot testing of human 1) SW620 and 2) COLO320 cell lysate with GAL4 antibody. Expected molecular weight ~36 kDa.
IF/ICC staining of FFPE human A431 cells with GAL4 antibody (green) at 2ug/ml and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Flow cytometry testing of human ThP1 cells with GAL4 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= GAL4 antibody.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R32387-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml,Immunofluorescence/Immunocytochemistry (FFPE): 2-4ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the GAL4 antibody should be determined by the researcher.
Description:
Galectin-4 is a protein that in humans is encoded by the LGALS4 gene. This gene is mapped to chromosome 19q13.2 based on an alignment of the LGALS4 sequence. The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS4 is an S-type lectin that is strongly underexpressed in colorectal cancer. The 323-amino acid LGALS4 protein contains 2 homologous, approximately 150-amino acid carbohydrate recognition domains and all amino acids typically conserved in galectins.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids DRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSY were used as the immunogen for the GAL4 antibody.
Limitation:
This GAL4 antibody is available for research use only.
Purity:
Antigen affinity
Species Reactivity :
Human
Uniprot #:
P56470