NSJ Bioreagents

Keratocan Antibody

Product Code:
 
NSJ-R31830
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
Application:
 
Western Blot (WB)
Storage:
 
After reconstitution, the Keratocan antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 1
Western blot testing of 1) mouse testis, 2) mouse skeletal muscle, 3) human MCF7 and 4) human A549 lysate with Keratocan antibody. Predicted molecular weight ~40 kDa but the mature protein can be observed ~52 kDa with possible 34/37 kDa breakdown products. (Ref 1)
❮❯

Western blot testing of 1) mouse testis, 2) mouse skeletal muscle, 3) human MCF7 and 4) human A549 lysate with Keratocan antibody. Predicted molecular weight ~40 kDa but the mature protein can be observed ~52 kDa with possible 34/37 kDa breakdown products. (Ref 1)

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R31830-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
How to order with us   Contact us
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml
Application Note:
Optimal dilution of the Keratocan antibody should be determined by the researcher.
Description:
Keratocan (KTN), also known as keratan sulfate proteoglycan keratocan, is a protein that in humans is encoded by the KERA gene. It is mapped to 12q22. The protein encoded by this gene is a keratan sulfate proteoglycan that is involved in corneal transparency. Defects in this gene are a cause of autosomal recessive cornea plana 2 (CNA2). Keratan sulfate proteoglycans (KSPGs) are members of the small leucine-rich proteoglycan (SLRP) family. KSPGs, particularly keratocan, lumican and mimecan, are important to the transparency of the cornea.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids YLQNNLIETIPEKPFENATQLRWINLNKNKITN of human Keratocan were used as the immunogen for the Keratocan antibody.
Limitation:
This Keratocan antibody is available for research use only.
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse
Uniprot #:
O60938