NSJ Bioreagents

MMP9 Antibody / Matrix Metalloproteinase-9

Product Code:
 
NSJ-R32445
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
Prior to reconstitution, store at 40. After reconstitution, the MMP-9 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 3
Western blot testing of rat NRK cell lysate with MMP-9 antibody at 0.5ug/ml. Predicted molecular weight: 92/67-80 kDa (precursor/mature forms).
2 / 3
IHC testing of FFPE mouse spleen tissue with MMP-9 antibody at 1ug/ml. HIER: steam in pH6 citrate buffer and allow to cool prior to staining.
3 / 3
IHC testing of FFPE rat spleen tissue with MMP-9 antibody at 1ug/ml. HIER: steam in pH6 citrate buffer and allow to cool prior to staining.

Western blot testing of rat NRK cell lysate with MMP-9 antibody at 0.5ug/ml. Predicted molecular weight: 92/67-80 kDa (precursor/mature forms).
IHC testing of FFPE mouse spleen tissue with MMP-9 antibody at 1ug/ml. HIER: steam in pH6 citrate buffer and allow to cool prior to staining.
IHC testing of FFPE rat spleen tissue with MMP-9 antibody at 1ug/ml. HIER: steam in pH6 citrate buffer and allow to cool prior to staining.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R32445-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml
Buffer:
Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
Description:
Matrix metallopeptidase 9 (MMP-9), also known as 92 kDa type IV collagenase, 92 kDa gelatinase or gelatinase B (GELB), is an enzyme that in humans is encoded by the MMP9 gene. Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes. Most MMPs are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The enzyme encoded by this gene degrades type IV and V collagens. Studies in rhesus monkeys suggest that the enzyme is involved in IL-8-induced mobilization of hematopoietic progenitor cells from bone marrow, and murine studies suggest a role in tumor-associated tissue remodeling.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids RRGGKALLISRERIWKFDLKSQKVDPQSVTRLDNEFS were used as the immunogen for the MMP-9 antibody.
Limitation:
This MMP-9 antibody is available for research use only.
Localization:
Nuclear, cytoplasmic
Purity:
Antigen affinity
Species Reactivity :
Mouse, Rat
Uniprot #:
P50282