NSJ Bioreagents

UNC5C Antibody

Product Code:
 
NSJ-R31843
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Western Blot (WB)
Storage:
 
After reconstitution the UNC5C antibody can be stored for up to one month at 40. For long-term aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 2
Western blot testing of 1) rat brain, 2) mouse brain and 3) human HeLa lysate with UNC5C antibody. Predicted molecular weight ~103 kDa, observed here at ~115 kDa.
2 / 2
Flow cytometry testing of human SH-SY5Y cells with UNC5C antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= UNC5C antibody.
❮❯

Western blot testing of 1) rat brain, 2) mouse brain and 3) human HeLa lysate with UNC5C antibody. Predicted molecular weight ~103 kDa, observed here at ~115 kDa.
Flow cytometry testing of human SH-SY5Y cells with UNC5C antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= UNC5C antibody.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R31843-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
How to order with us   Contact us
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details:
Western blot: 0.1-0.5ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the UNC5C antibody should be determined by the researcher.
Description:
Netrin receptor UNC5C is a protein that in humans is encoded by the UNC5C gene. This gene product belongs to the UNC-5 family of netrin receptors. Netrins are secreted proteins that direct axon extension and cell migration during neural development. They are bifunctional proteins that act as attractants for some cell types and as repellents for others, and these opposite actions are thought to be mediated by two classes of receptors. The UNC-5 family of receptors mediates the repellent response to netrin; they are transmembrane proteins containing 2 immunoglobulin (Ig)-like domains and 2 type I thrombospondin motifs in the extracellular region.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids DLWEAQNFPDGNLSMLAAVLEEMGRHETVVSLAAEGQ of human UNC5C were used as the immunogen for the UNC5C antibody.
Limitation:
This UNC5C antibody is available for research use only.
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
O95185