NSJ Bioreagents

WNT7A Antibody

Product Code:
 
NSJ-R31793
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the WNT7A antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 2
Flow cytometry testing of human PC-3 cells with WNT7A antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= WNT7A antibody.~
2 / 2
Western blot testing of 1) human HCCT, 2) human HCCP, 3) rat kidney, 4) ra
❮❯

Flow cytometry testing of human PC-3 cells with WNT7A antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= WNT7A antibody.~
Western blot testing of 1) human HCCT, 2) human HCCP, 3) rat kidney, 4) ra

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R31793-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
How to order with us   Contact us
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml,Immunohistochemistry (FFPE): 0.5-1ug/ml
Application Note:
Optimal dilution of the WNT7A antibody should be determined by the researcher.
Description:
This gene is a member of the WNT gene family, which consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is involved in the development of the anterior-posterior axis in the female reproductive tract, and also plays a critical role in uterine smooth muscle pattering and maintenance of adult uterine function. Mutations in this gene are associated with Fuhrmann and Al-Awadi / Raas ? Rothschild / Schinzel phocomelia syndromes.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids YVLKDKYNEAVHVEPVRASRNKRPTFLKIKK of human WNT7A were used as the immunogen for the WNT7A antibody.
Limitation:
This WNT7A antibody is available for research use only.
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
O00755