NSJ Bioreagents

PDIA3 Antibody / ERp57 [Clone 7E5.] (Antigen affinity purified)

Product Code:
 
NSJ-RQ7021
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Mouse
Antibody Isotype:
 
Mouse IgG1
Antibody Clonality:
 
Monoclonal
Antibody Clone:
 
7E5.
Regulatory Status:
 
RUO
Target Species:
 
Human
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the ERp57 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
1 / 3
IHC staining of FFPE human rectal cancer tissue with ERp57 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
2 / 3
Western blot testing of human 1) placenta, 2) A549, 3) SW620, 4) HEK293, 5) K562 and 6) Raji cell lysate with ERp57 antibody. Predicted molecular weight: ~57-60 kDa.
3 / 3
Flow cytometry testing of human U-87 MG cells with ERp57 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= ERp57 antibody.

IHC staining of FFPE human rectal cancer tissue with ERp57 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Western blot testing of human 1) placenta, 2) A549, 3) SW620, 4) HEK293, 5) K562 and 6) Raji cell lysate with ERp57 antibody. Predicted molecular weight: ~57-60 kDa.
Flow cytometry testing of human U-87 MG cells with ERp57 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= ERp57 antibody.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-RQ7021-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details:
Western blot: 0.5-1 ug/ml,Immunohistochemistry (FFPE): 2-5ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the ERp57 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose
Description:
PDIA3 (Protein disulfide isomerase family A, member 3), also called GRP58, Erp57 or ER60, is an isomerase enzyme. It is mapped on 15q15.3. PDIA3 is also part of the major histocompatibility complex (MHC) class I peptide-loading complex, which is essential for formation of the final antigen conformation and export from the endoplasmic reticulum to the cell surface. This gene encodes a protein of the endoplasmic reticulum that interacts with lectin chaperones calreticulin and calnexin to modulate folding of newly synthesized glycoproteins. The protein was once thought to be a phospholipase; however, it has been demonstrated that the protein actually has protein disulfide isomerase activity. It is thought that complexes of lectins and this protein mediate protein folding by promoting formation of disulfide bonds in their glycoprotein substrates.
Format:
Antigen affinity purified
Formulation:
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
C-terminal amino acids RELSDFISYLQREATNPPVIQEEKPKKKKKAQEDL were used as the immunogen for the ERp57 antibody.
Limitation:
This ERp57 antibody is available for research use only.
Localization:
Cytoplasmic
Purity:
Antigen affinity purified
Uniprot #:
P30101

Documents