NSJ Bioreagents

YY1 Antibody [Clone 2C10F9] (Antigen affinity purified)

Product Code:
 
NSJ-RQ7050
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Mouse
Antibody Isotype:
 
Mouse IgG2a
Antibody Clonality:
 
Monoclonal
Antibody Clone:
 
2C10F9
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the YY1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
1 / 6
IHC staining of FFPE human laryngeal squamous cell carcinoma tissue with YY1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
2 / 6
IHC staining of FFPE human thyroid cancer tissue with YY1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
3 / 6
IHC staining of FFPE human pancreatic ductal adenocarcinoma tissue with YY1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
4 / 6
IHC staining of FFPE human renal clear cell carcinoma tissue with YY1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
5 / 6
Western blot testing of 1) human Caco-2, 2) human SW620, 3) human MDA-MB-453, 4) human PC-3, 5) rat thymus and 6) mouse thymus tissue lysate with YY11 antibody. Predicted molecular weight ~45 kDa but commonly observed at 45~65 kDa.
6 / 6
Flow cytometry testing of human PC-3 cells with YY1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= YY1 antibody.
❮❯

IHC staining of FFPE human laryngeal squamous cell carcinoma tissue with YY1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human thyroid cancer tissue with YY1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human pancreatic ductal adenocarcinoma tissue with YY1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human renal clear cell carcinoma tissue with YY1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Western blot testing of 1) human Caco-2, 2) human SW620, 3) human MDA-MB-453, 4) human PC-3, 5) rat thymus and 6) mouse thymus tissue lysate with YY11 antibody. Predicted molecular weight ~45 kDa but commonly observed at 45~65 kDa.
Flow cytometry testing of human PC-3 cells with YY1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= YY1 antibody.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-RQ7050-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
How to order with us   Contact us
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details:
Western blot: 0.5-1 ug/ml,Immunohistochemistry (FFPE): 2-5ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the YY1 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose
Description:
YY1 (Yin Yang 1) is a transcriptional repressor protein in humans that is encoded by the YY1 gene. YY1 is a ubiquitously distributed transcription factor belonging to the GLI-Kruppel class of zinc finger proteins. The protein is involved in repressing and activating a diverse number of promoters. YY1 may direct histone deacetylases and histone acetyltransferases to a promoter in order to activate or repress the promoter, thus implicating histone modification in the function of YY1.
Format:
Antigen affinity purified
Formulation:
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids EQKQVQIKTLEGEFSVTMWSSDEKKDIDHETVVEEQ were used as the immunogen for the YY1 antibody.
Limitation:
This YY1 antibody is available for research use only.
Localization:
Nuclear
Purity:
Antigen affinity purified
Uniprot #:
P25490

Documents