NSJ Bioreagents

Aconitase 2 Antibody

Product Code:
 
NSJ-R32458
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Application:
 
Western Blot (WB)
Storage:
 
Prior to reconstitution store at 40. After reconstitution the Aconitase 2 antibody can be stored for up to one month at 40. For long-term aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 1
Western blot testing of 1) human HeLa, 2) human U-87 MG, 3) human Jurkat, 4) human HepG2, 5) rat brain, 6) rat skeletal muscle, 7) mouse brain and 8) mouse skeletal muscle tissue lysate with Aconitase 2 antibody. Predicted molecular weight: ~85 kDa.

Western blot testing of 1) human HeLa, 2) human U-87 MG, 3) human Jurkat, 4) human HepG2, 5) rat brain, 6) rat skeletal muscle, 7) mouse brain and 8) mouse skeletal muscle tissue lysate with Aconitase 2 antibody. Predicted molecular weight: ~85 kDa.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R32458-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details:
Western blot: 0.5-1ug/ml
Buffer:
Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
Description:
Aconitase 2, mitochondrial is a protein that in humans is encoded by the ACO2 gene. The protein encoded by this gene belongs to the aconitase/IPM isomerase family. It is an enzyme that catalyzes the interconversion of citrate to isocitrate via cis-aconitate in the second step of the TCA cycle. This protein is encoded in the nucleus and functions in the mitochondrion. It was found to be one of the mitochondrial matrix proteins that are preferentially degraded by the serine protease 15(PRSS15), also known as Lon protease, after oxidative modification.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids TSQRLQLLEPFDKWDGKDLEDLQILIKVKGKCTTDH from the human protein were used as the immunogen for the Aconitase 2 antibody.
Limitation:
This Aconitase 2 antibody is available for research use only.
Localization:
Cytoplasmic
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
Q99798