NSJ Bioreagents

AKAP2 Antibody

Product Code:
 
NSJ-R32805
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
Application:
 
Western Blot (WB)
Storage:
 
After reconstitution the AKAP2 antibody can be stored for up to one month at 40. For long-term aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 1
Western blot testing of 1) human PC-3 and 2) mouse lung tissue lysate with AKAP2 antibody at 0.5ug/ml. Predicted molecular weight ~95 kDa (multiple isoforms).
❮❯

Western blot testing of 1) human PC-3 and 2) mouse lung tissue lysate with AKAP2 antibody at 0.5ug/ml. Predicted molecular weight ~95 kDa (multiple isoforms).

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R32805-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT
How to order with us   Contact us
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.5-1ug/ml
Application Note:
Optimal dilution of the AKAP2 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
Description:
A-kinase anchor protein 2 is an enzyme that in humans is encoded by the AKAP2 gene. It is mapped to 9q31.3. The protein encoded by this gene binds to the regulatory subunit of protein kinase A and is found associated with the actin cytoskeleton. The encoded protein mediates signals carried by cAMP and may be involved in creating polarity in certain signaling processes. Three transcript variants encoding different isoforms have been found for this gene.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids 813-852 (ETHKSKRRERMDDSSVLEATRVNRRKSALALRWEAGIYAN) from the human protein were used as the immunogen for the AKAP2 antibody.
Limitation:
This AKAP2 antibody is available for research use only.
Purity:
Antigen affinity
Species Reactivity :
Human, Rat
Uniprot #:
Q9Y2D5