NSJ Bioreagents

CCKBR Antibody

Product Code:
 
NSJ-RQ4324
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Western Blot (WB)
Storage:
 
After reconstitution, the CCKBR antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 3
Western blot testing of human 1) PANC-1, 2) U-87 MG, 3) COLO-320 and 4) SGC-7901 cell lysate with CCKBR antibody at 0.5ug/ml. Predicted molecular weight ~48 kDa, but can be observed at 68-97 kDa.
2 / 3
Western blot testing of 1) rat brain, 2) rat stomach and 3) mouse brain lysate with CCKBR antibody at 0.5ug/ml. Predicted molecular weight ~48 kDa, but can be observed at 68-97 kDa.
3 / 3
Flow cytometry testing of human LoVo cells with CCKBR antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=CCKBR antibody.
❮❯

Western blot testing of human 1) PANC-1, 2) U-87 MG, 3) COLO-320 and 4) SGC-7901 cell lysate with CCKBR antibody at 0.5ug/ml. Predicted molecular weight ~48 kDa, but can be observed at 68-97 kDa.
Western blot testing of 1) rat brain, 2) rat stomach and 3) mouse brain lysate with CCKBR antibody at 0.5ug/ml. Predicted molecular weight ~48 kDa, but can be observed at 68-97 kDa.
Flow cytometry testing of human LoVo cells with CCKBR antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=CCKBR antibody.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-RQ4324-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
How to order with us   Contact us
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the CCKBR antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
The cholecystokinin B receptor, also known as CCKBR or CCK2, is a protein that in humans is encoded by the CCKBR gene. This gene encodes a G-protein coupled receptor for gastrin and cholecystokinin (CCK), regulatory peptides of the brain and gastrointestinal tract. This protein is a type B gastrin receptor, which has a high affinity for both sulfated and nonsulfated CCK analogs and is found principally in the central nervous system and the gastrointestinal tract. Alternative splicing results in multiple transcript variants. A misspliced transcript variant including an intron has been observed in cells from colorectal and pancreatic tumors.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids PVYTVVQPVGPRVLQCVHRWPSARVRQTWS were used as the immunogen for the CCKBR antibody.
Limitation:
This CCKBR antibody is available for research use only.
Localization:
Cell membrane
Purity:
Antigen affinity purified
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
P32239