NSJ Bioreagents

Cd46 Antibody

Product Code:
 
NSJ-R31841
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
 
Mouse
Application:
 
Western Blot (WB)
Storage:
 
After reconstitution, the Cd46 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 1
Western blot testing of 1) mouse testis and 2) mouse NIH3T3 lysate with Cd46 antibody. Observed molecular weight: 41~70 kDa depending on glycosylation level.

Western blot testing of 1) mouse testis and 2) mouse NIH3T3 lysate with Cd46 antibody. Observed molecular weight: 41~70 kDa depending on glycosylation level.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R31841-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml
Application Note:
Optimal dilution of the Cd46 antibody should be determined by the researcher.
Description:
CD46 complement regulatory protein,also known as CD46 (cluster of differentiation 46) andMembrane Cofactor Protein,is aproteinwhich in humans is encoded by the CD46 gene. The protein encoded by this gene is a type I membrane protein and is a regulatory part of the complement system. And the encoded protein has cofactor activity for inactivation of complement components C3b and C4b by serum factor I, which protects the host cell from damage by complement. In addition, the encoded protein can act as a receptor for the Edmonston strain of measles virus, human herpesvirus-6, and type IV pili of pathogenic Neisseria. Finally, the protein encoded by this gene may be involved in the fusion of the spermatozoa with the oocyte during fertilization. Mutations at this locus have been associated with susceptibility to hemolytic uremic syndrome. Alternatively spliced transcript variants encoding different isoforms have been described.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids ELPRPFEAMELKGTPKLFYAVGEKIEYKCKK of mouse Cd46 were used as the immunogen for the Cd46 antibody.
Limitation:
This Cd46 antibody is available for research use only.
Purity:
Antigen affinity
Species Reactivity :
Mouse
Uniprot #:
O88174