NSJ Bioreagents

CYP2D6 Antibody

Product Code:
 
NSJ-R32678
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the CYP2D6 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 5
IHC testing of FFPE human liver cancer tissue with CYP2D6 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
2 / 5
IHC testing of FFPE mouse liver tissue with CYP2D6 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
3 / 5
IHC testing of FFPE mouse intestine tissue with CYP2D6 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
4 / 5
IHC testing of FFPE rat intestine tissue with CYP2D6 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
5 / 5
Western blot testing of 1) rat liver and 2) mouse liver tissue with CYP2D6 antibody at 0.5ug/ml. Predicted molecular weight ~56 kDa.

IHC testing of FFPE human liver cancer tissue with CYP2D6 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
IHC testing of FFPE mouse liver tissue with CYP2D6 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
IHC testing of FFPE mouse intestine tissue with CYP2D6 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
IHC testing of FFPE rat intestine tissue with CYP2D6 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
Western blot testing of 1) rat liver and 2) mouse liver tissue with CYP2D6 antibody at 0.5ug/ml. Predicted molecular weight ~56 kDa.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R32678-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml
Application Note:
Optimal dilution of the CYP2D6 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
Description:
Cytochrome P450 2D6 (CYP2D6) is one of the most important enzymes involved in the metabolism of xenobiotics in the body. It is a member of Cytochrome P450, family 2, subfamily D, polypeptide 6. This gene is mapped to chromosome 22q13.1. It has got 497 amino acid proteins which shares 73% sequence identity with the rat protein. CYP2D6 is highly expressed in human liver and it is the major isozyme involved in the formation of N-hydroxyprocainamide, a metabolite potentially involved in the drug-induced lupus syndrome observed with procainamide.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids 315-347 (AWGLLLMILHPDVQRRVQQEIDDVIGQVRRPEM) from the human protein were used as the immunogen for the CYP2D6 antibody.
Limitation:
This CYP2D6 antibody is available for research use only.
Localization:
Cytoplasmic
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
P10635