NSJ Bioreagents

Fetuin-A Antibody / AHSG

Product Code:
 
NSJ-R31869
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Rat
Applications:
  • Enzyme-Linked Immunosorbent Assay (ELISA)
  • Fluorescence-activated cell sorting (FACS)
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the AHSG antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 3
Western blot testing of 1) rat brain, 2) human RH35 and 3) MCF7 lysate with AHSG antibody. Expected molecular weight ~39/45-55 kDa (unmodified/glycosylated).
2 / 3
IHC testing of FFPE human liver cancer tissue with AHSG antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
3 / 3
Flow cytometry testing of human HepG2 cells with AHSG antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= AHSG antibody.

Western blot testing of 1) rat brain, 2) human RH35 and 3) MCF7 lysate with AHSG antibody. Expected molecular weight ~39/45-55 kDa (unmodified/glycosylated).
IHC testing of FFPE human liver cancer tissue with AHSG antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
Flow cytometry testing of human HepG2 cells with AHSG antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= AHSG antibody.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R31869-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml,Immunohistochemistry (FFPE): 0.5-1ug/ml,Flow cytometry: 1-3ug/million cells,ELISA: 0.1-0.5ug/ml (human protein tested)
Application Note:
Optimal dilution of the AHSG antibody should be determined by the researcher.
Description:
Alpha-2-HS-glycoprotein (AHSG), also known as Fetuin-A, is a protein that in humans is encoded by the AHSG gene. Fetuin-A belongs to the fetuin class of plasma binding proteins and is more abundant in fetal than adult blood. Its gene is mapped to 3q27. The protein is commonly present in the cortical plate of the immature cerebral cortex and bone marrow hemopoietic matrix. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids DDPETEEAALVAIDYINQNLPWGYKHTLNQIDE of human AHSG were used as the immunogen for the AHSG antibody.
Limitation:
This AHSG antibody is available for research use only.
Purity:
Antigen affinity
Species Reactivity :
Human, Rat
Uniprot #:
P02765