NSJ Bioreagents

FMO2 Antibody

Product Code:
 
NSJ-R32311
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
 
Human
Application:
 
Western Blot (WB)
Storage:
 
After reconstitution, the FMO2 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 1
Western blot testing of human 1) A549, 2) HeLa, 3) MCF7, 4) SW620 cell lysate with FMO2 antibody. Expected/observed molecular weigth ~54 kDa.
❮❯

Western blot testing of human 1) A549, 2) HeLa, 3) MCF7, 4) SW620 cell lysate with FMO2 antibody. Expected/observed molecular weigth ~54 kDa.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R32311-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
How to order with us   Contact us
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml
Application Note:
Optimal dilution of the FMO2 antibody should be determined by the researcher.
Description:
Dimethylaniline monooxygenase [N-oxide-forming] 2 is an enzyme that in humans is encoded by the FMO2 gene (flavin containing monooxygenase 2). It is an NADPH-dependent enzyme that catalyzes the N-oxidation of some primary alkylamines through an N-hydroxylamine intermediate. However, some human populations contain an allele (FMO2*2A) with a premature stop codon, resulting in a protein that is C-terminally-truncated, has no catalytic activity, and is likely degraded rapidly. This gene is found in a cluster with other related family members on chromosome 1. Alternative splicing results in multiple transcript variants.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids FPNFLHNSKLLEYFRIFAKKFDLLKYIQFQTTVLSVRK of human FMO2 were used as the immunogen for the FMO2 antibody.
Limitation:
This FMO2 antibody is available for research use only.
Purity:
Antigen affinity
Species Reactivity :
Human
Uniprot #:
Q99518