NSJ Bioreagents

MDM4 Antibody / MDMX

Product Code:
 
NSJ-R31805
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the MDM4 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 1
Western blot testing of 1) mouse testis and 2) human 22RV1 lysate with MDM4 antibody. Predicted molecular weight ~55 kDa but routinely observed at ~80 kDa.

Western blot testing of 1) mouse testis and 2) human 22RV1 lysate with MDM4 antibody. Predicted molecular weight ~55 kDa but routinely observed at ~80 kDa.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R31805-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml,Immunohistochemistry (FFPE): 0.5-1ug/ml
Application Note:
Optimal dilution of the MDM4 antibody should be determined by the researcher.
Description:
Protein Mdm4 is a protein that in humans is encoded by the MDM4 gene. This gene encodes a nuclear protein that contains a p53 binding domain at the N-terminus and a RING finger domain at the C-terminus, and shows structural similarity to p53-binding protein MDM2. Both proteins bind the p53 tumor suppressor protein and inhibit its activity, and have been shown to be overexpressed in a variety of human cancers. However, unlike MDM2 which degrades p53, this protein inhibits p53 by binding its transcriptional activation domain. This protein also interacts with MDM2 protein via the RING finger domain, and inhibits the latter's degradation. So this protein can reverse MDM2-targeted degradation of p53, while maintaining suppression of p53 transactivation and apoptotic functions. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids KILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQH of human MDM4 were used as the immunogen for the MDM4 antibody.
Limitation:
This MDM4 antibody is available for research use only.
PM_Meta_Key:
Product_Images
PM_Meta_Value:
https://www.nsjbio.com/get_image.php?catalog_no=R31805&type=image1~Western blot testing of 1) mouse testis and 2) human 22RV1 lysate with MDM4 antibody. Predicted molecular weight ~55 kDa but routinely observed at ~80 kDa.|https://www.nsjbio.com/get_image.php?catalog_no=R31805&type=image2~IHC staining of FFPE human lung cancer tissue with MDM4 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse
Uniprot #:
O15151