NSJ Bioreagents

MMP3 Antibody

Product Code:
 
NSJ-R31680
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
 
Human
Application:
 
Western Blot (WB)
Storage:
 
After reconstitution, the MMP3 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 2
Western blot testing of MMP3 antibody and Lane 1: human placenta; 2: U20S; 3: HeLa; 4: PANC; 5: COLO320~
2 / 2
Western blot testing of MMP3 antibody and recombinant human protein (0.5ng)

Western blot testing of MMP3 antibody and Lane 1: human placenta; 2: U20S; 3: HeLa; 4: PANC; 5: COLO320~
Western blot testing of MMP3 antibody and recombinant human protein (0.5ng)

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R31680-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.5-1ug/ml
Application Note:
The stated application concentrations are suggested starting amounts. Titration of the MMP3 antibody may be required due to differences in protocols and secondary/substrate sensitivity.
Description:
Stromelysin-1, also known as Matrix metalloproteinase-3 (MMP-3), is an enzyme that in humans is encoded by the MMP3 gene. It is mapped to 11q22.2. Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix and during tissue remodeling in normal physiological processes, such as embryonic development and reproduction, as well as in disease processes, such as arthritis, and tumour metastasis. The MMP3 enzyme degrades collagen types II, III, IV, IX, and X, proteoglycans, fibronectin, laminin, and elastin. In addition, it can also activate other MMPs such as MMP1, MMP7, and MMP9, rendering MMP3 crucial in connective tissue remodeling. The enzyme is thought to be involved in wound repair, progression of atherosclerosis, and tumor initiation.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Gene ID #:
4314
Immunogen:
An amino acid sequence from the C-terminal of human MMP3 (RFDEKRNSMEPGFPKQIAEDFPGIDSKIDA) was used as the immunogen for this MMP3 antibody.
Limitation:
This MMP3 antibody is available for research use only.
Purity:
Antigen affinity
Species Reactivity :
Human