NSJ Bioreagents

TIMP3 Antibody

Product Code:
 
NSJ-R32715
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Enzyme-Linked Immunosorbent Assay (ELISA)
  • Western Blot (WB)
Storage:
 
After reconstitution, the TIMP3 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 1
Western blot testing of 1) rat kidney and 2) mouse NIH3T3 lysate with TIMP3 antibody at 0.5ug/ml. Predicted molecular weight ~24 kDa (unmodified) and ~33 kDa (glycosylated).
❮❯

Western blot testing of 1) rat kidney and 2) mouse NIH3T3 lysate with TIMP3 antibody at 0.5ug/ml. Predicted molecular weight ~24 kDa (unmodified) and ~33 kDa (glycosylated).

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R32715-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT
How to order with us   Contact us
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.5-1ug/ml,ELISA: 0.1-0.5ug/ml (human protein tested; request BSA-free format for coating)
Application Note:
Optimal dilution of the TIMP3 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
Description:
Metalloproteinase inhibitor 3 is a protein that in humans is encoded by the TIMP3 gene. It is mapped to 22q12.1-q13.2. This gene belongs to the tissue inhibitor of metalloproteinases gene family. The proteins encoded by this gene family are inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of theextracellular matrix (ECM). Expression of this gene is induced in response to mitogenic stimulation and this netrin domain-containing protein is localized to the ECM. Mutations in this gene have been associated with the autosomal dominant disorder Sorsby's fundus dystrophy.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids 107-141 (RVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHL) from the human protein were used as the immunogen for the TIMP3 antibody.
Limitation:
This TIMP3 antibody is available for research use only.
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
P35625